PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G0882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 317aa    MW: 34581.2 Da    PI: 4.7561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G0882genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g W+  +++ g+ R++k+c++rw +yl
      Gh_D03G0882 14 KGAWTAEEDQKLISYIQKHGEGGWRFLPQKAGLQRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.85.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eEd+ ++++ ++lG++ W++Iar+++ +Rt++++k++w+ +
      Gh_D03G0882  67 RGDFTPEEDKTIIKLQAELGNR-WAAIARHLP-NRTDNEIKNYWNAH 111
                      899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.333961IPR017930Myb domain
SuperFamilySSF466893.88E-3111108IPR009057Homeodomain-like
SMARTSM007177.1E-121363IPR001005SANT/Myb domain
PfamPF002493.0E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-241568IPR009057Homeodomain-like
CDDcd001673.41E-101661No hitNo description
PROSITE profilePS5129426.46862116IPR017930Myb domain
SMARTSM007173.2E-1866114IPR001005SANT/Myb domain
PfamPF002491.1E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2669116IPR009057Homeodomain-like
CDDcd001671.02E-1370112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRTPFCSSD GLKKGAWTAE EDQKLISYIQ KHGEGGWRFL PQKAGLQRCG KSCRLRWANY  60
LRPGIKRGDF TPEEDKTIIK LQAELGNRWA AIARHLPNRT DNEIKNYWNA HLKKRLASMG  120
ADQVTVSGGA SSSGNSDSNA VTDTECAKPQ QSEPTKQRSA SALLLNKLAT RVTQCVGRLR  180
ASQTLQQPTM PFNGGAESSD IFCHPLPSST PESTSWADNN NSSNSLTIPE CGTTNAIDER  240
DSSSSAGVLN DIVASEFASP TCVDELSDWV NTNYSIEPEQ VQIDYSDSMT VGYGGLWDDD  300
VIVVDDDDYT VGSLGFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-28121162105C-Myb DNA-Binding Domain
1mse_C2e-28121162105C-Myb DNA-Binding Domain
1gv2_A2e-28121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470775.10.0PREDICTED: transcription factor MYB34
SwissprotQ9SPG22e-66MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A0D2MLR50.0A0A0D2MLR5_G
STRINGAT5G61420.25e-64(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.12e-65myb domain protein 34